PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00195.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 296aa    MW: 33660.7 Da    PI: 6.3666
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00195.1_g00031.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.44.4e-5651311129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL++kv+++ ++  +++ +vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+t
  Rsa1.0_00195.1_g00031.1   5 LPPGFRFHPTDEELITHYLCRKVSDNGFTG-KAVVDVDLNKCEPWDLPDKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTT 89 
                              79*************************999.88***************988999******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +g lvg+kktLvfykgrapkgek++Wvmheyrle
  Rsa1.0_00195.1_g00031.1  90 GKDKEIYR-SGMLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-653151IPR003441NAC domain
PROSITE profilePS5100560.3415151IPR003441NAC domain
PfamPF023653.6E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT HYLCRKVSDN GFTGKAVVDV DLNKCEPWDL PDKASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRSGM LVGMKKTLVF YKGRAPKGEK  120
SNWVMHEYRL ETKQPFTPAK EEWVVCRVFQ KSTATKKPQE QQPQSSFGSP CDAISSMANE  180
FEDIELPNLN SNSSTVDYNH IHQQLYSQNN VYSDNTTSTA GLNMNMANNL PAWTTSLLGP  240
PLSPINSLLL KAFQIRNSYN INPSLLQQGV SNVMQDGSSS SQPQPQEEAF NMDSLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-59415716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-59415716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-59415716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-59415716171NO APICAL MERISTEM PROTEIN
3swm_A2e-59415719174NAC domain-containing protein 19
3swm_B2e-59415719174NAC domain-containing protein 19
3swm_C2e-59415719174NAC domain-containing protein 19
3swm_D2e-59415719174NAC domain-containing protein 19
3swp_A2e-59415719174NAC domain-containing protein 19
3swp_B2e-59415719174NAC domain-containing protein 19
3swp_C2e-59415719174NAC domain-containing protein 19
3swp_D2e-59415719174NAC domain-containing protein 19
4dul_A2e-59415716171NAC domain-containing protein 19
4dul_B2e-59415716171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266583e-77AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24.
GenBankCP0026863e-77CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112744.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_013675277.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ27e-84NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A078FZB90.0A0A078FZB9_BRANA; BnaA01g26760D protein
STRINGBra037585.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55272649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-175NAC domain containing protein 58